
Atlas Antibodies Anti-PAAF1 Antibody
상품 한눈에 보기
인간 PAAF1 단백질을 인식하는 폴리클로날 항체로, WB 및 IHC에 적합. Rabbit에서 생산된 IgG 형 항체이며, PrEST 항원을 이용해 친화 정제됨. 인간에 대한 반응성이 검증되었으며, 보존용으로 sodium azide가 포함됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PAAF1 Antibody
Target Information
- Target Protein: Proteasomal ATPase-associated factor 1
- Target Gene: PAAF1
- Alternative Gene Names: FLJ11848, Rpn14, WDR71
Product Description
Polyclonal antibody against Human PAAF1 (proteasomal ATPase-associated factor 1).
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
GNIYQLDVRSPRAPVQVIHRSGAPVLSLLSVRDGFIASQGDGSCFIVQQDLDYVTELTGADCDPVYKVATWEKQIYTCCRDGLVRRYQLSDL
Species Reactivity
- Verified Species: Human
- Interspecies Information:
- Rat (ENSGNOG00000011470) – 22% identity
- Mouse (ENSMUSG00000022346) – 20% identity
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
- 40% glycerol and PBS (pH 7.2)
- Contains 0.02% sodium azide as preservative
- Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PABPC1L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PABPC1L2A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PAAF1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PAAF1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PA2G4 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.