CacheBy
Atlas Antibodies Anti-PABPC1L Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PABPC1L Antibody

상품 한눈에 보기

Human PABPC1L 단백질을 인식하는 토끼 폴리클로날 항체. 면역세포화학(ICC) 등 다양한 연구 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 40% 글리세롤 및 PBS 완충액에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA066650-100 Anti-PABPC1L Antibody, poly(A) binding protein, cytoplasmic 1-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA066650-25 Anti-PABPC1L Antibody, poly(A) binding protein, cytoplasmic 1-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PABPC1L Antibody

Anti-PABPC1L Antibody

Target: poly(A) binding protein, cytoplasmic 1-like (PABPC1L)
Type: Polyclonal Antibody (Rabbit)

Product Description

Polyclonal antibody against human PABPC1L, also known as poly(A) binding protein, cytoplasmic 1-like. Suitable for use in immunocytochemistry and related applications.

Alternative Gene Names

C20orf119, dJ1069P2.3, ePAB, PABPC1L1

Open Datasheet

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
Antigen Sequence:
ILTNQYMQRLSTMRTLSNPLLGSFQQPSSYFLPAMPQPPAQAAYYGCGPVTPTQP

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000054582 58%
Rat ENSRNOG00000012750 49%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.