
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PABPC1L Antibody
상품 한눈에 보기
Human PABPC1L 단백질을 인식하는 토끼 폴리클로날 항체. 면역세포화학(ICC) 등 다양한 연구 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 40% 글리세롤 및 PBS 완충액에 보존.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA066650-100 Anti-PABPC1L Antibody, poly(A) binding protein, cytoplasmic 1-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA066650-25 Anti-PABPC1L Antibody, poly(A) binding protein, cytoplasmic 1-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PABPC1L Antibody
Anti-PABPC1L Antibody
Target: poly(A) binding protein, cytoplasmic 1-like (PABPC1L)
Type: Polyclonal Antibody (Rabbit)
Product Description
Polyclonal antibody against human PABPC1L, also known as poly(A) binding protein, cytoplasmic 1-like. Suitable for use in immunocytochemistry and related applications.
Alternative Gene Names
C20orf119, dJ1069P2.3, ePAB, PABPC1L1
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
Antigen Sequence:
ILTNQYMQRLSTMRTLSNPLLGSFQQPSSYFLPAMPQPPAQAAYYGCGPVTPTQP
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000054582 | 58% |
| Rat | ENSRNOG00000012750 | 49% |
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



