
Thermo Fisher Scientific UHRF2 Polyclonal Antibody
UHRF2 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot 및 IHC(Paraffin) 분석에 적합합니다. Human, Mouse, Rat 시료에 반응하며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도를 가집니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human NIRF (15–54aa TIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLEN). |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747320 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene encodes a nuclear protein involved in cell-cycle regulation. The encoded protein functions as a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), potentially contributing to tumorigenesis. It contains multiple domains including NIRF_N, PHD finger, SRA, and RING finger domains, which are essential for the regulation of cell proliferation. This protein may also participate in intranuclear degradation of polyglutamine aggregates. Alternative splicing results in multiple transcript variants, some of which are non-protein coding.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific UPF3B Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific UGT1A1 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific UHRF2 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific UHRF1 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific UCP2 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|