Thermo Fisher Scientific UHRF2 Polyclonal Antibody
UHRF2 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot 및 IHC(Paraffin) 분석에 적합합니다. Human, Mouse, Rat 시료에 반응하며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도를 가집니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific UHRF2 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human NIRF (15–54aa TIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLEN). |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747320 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene encodes a nuclear protein involved in cell-cycle regulation. The encoded protein functions as a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), potentially contributing to tumorigenesis. It contains multiple domains including NIRF_N, PHD finger, SRA, and RING finger domains, which are essential for the regulation of cell proliferation. This protein may also participate in intranuclear degradation of polyglutamine aggregates. Alternative splicing results in multiple transcript variants, some of which are non-protein coding.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.