AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NTRK3 Antibody
상품 한눈에 보기
Human NTRK3 단백질을 인식하는 Rabbit Polyclonal 항체로, TRKC로도 알려진 neurotrophic tyrosine kinase receptor type 3를 검출합니다. Affinity purified 방식으로 정제되었으며, 다양한 응용 분야에 사용 가능합니다.
- 카탈로그번호
- HPA027484-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA027484-100 Anti-NTRK3 Antibody, neurotrophic tyrosine kinase, receptor, type 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027484-25 Anti-NTRK3 Antibody, neurotrophic tyrosine kinase, receptor, type 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NTRK3 Antibody
Anti-NTRK3 Antibody
Target: neurotrophic tyrosine kinase, receptor, type 3 (NTRK3, TRKC)
Type: Polyclonal Antibody against Human NTRK3
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human NTRK3 (neurotrophic tyrosine kinase, receptor, type 3).
Alternative Gene Names
- TRKC
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | neurotrophic tyrosine kinase, receptor, type 3 |
| Target Gene | NTRK3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse (98%), Rat (98%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
Antigen Sequence
CPANCVCSKTEINCRRPDDGNLFPLLEGQDSGNSNGNASINITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRSNotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.