CacheBy
Atlas Antibodies Anti-NTRK3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NTRK3 Antibody

상품 한눈에 보기

Human NTRK3 단백질을 인식하는 Rabbit Polyclonal 항체로, TRKC로도 알려진 neurotrophic tyrosine kinase receptor type 3를 검출합니다. Affinity purified 방식으로 정제되었으며, 다양한 응용 분야에 사용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA027484-100 Anti-NTRK3 Antibody, neurotrophic tyrosine kinase, receptor, type 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027484-25 Anti-NTRK3 Antibody, neurotrophic tyrosine kinase, receptor, type 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NTRK3 Antibody

Anti-NTRK3 Antibody

Target: neurotrophic tyrosine kinase, receptor, type 3 (NTRK3, TRKC)
Type: Polyclonal Antibody against Human NTRK3


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human NTRK3 (neurotrophic tyrosine kinase, receptor, type 3).


Alternative Gene Names

  • TRKC

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein neurotrophic tyrosine kinase, receptor, type 3
Target Gene NTRK3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Homology Mouse (98%), Rat (98%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)

Antigen Sequence

CPANCVCSKTEINCRRPDDGNLFPLLEGQDSGNSNGNASINITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRS

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.