CacheBy
Atlas Antibodies Anti-NTRK3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NTRK3 Antibody

상품 한눈에 보기

Human NTRK3 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity Purified 제품입니다. 신경영양성 타이로신 키나아제 수용체 연구에 적합하며, 높은 종 간 보존성을 보입니다. 40% glycerol 기반 PBS buffer에 보존됩니다.

카탈로그번호
HPA048065-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA048065-100 Anti-NTRK3 Antibody, neurotrophic tyrosine kinase, receptor, type 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048065-25 Anti-NTRK3 Antibody, neurotrophic tyrosine kinase, receptor, type 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NTRK3 Antibody

Anti-NTRK3 Antibody

Target: neurotrophic tyrosine kinase, receptor, type 3
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human NTRK3 (neurotrophic tyrosine kinase receptor type 3).


Alternative Gene Names

  • TRKC

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein neurotrophic tyrosine kinase, receptor, type 3
Target Gene NTRK3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence CPANCVCSKTEINCRRPDDGNLFPLLEGQDSGNSNGNASINITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRS

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000018674 (98%)
  • Mouse ENSMUSG00000059146 (98%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.