CacheBy
Atlas Antibodies Anti-NUB1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NUB1 Antibody

상품 한눈에 보기

Human NUB1 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형식. IHC 및 WB 응용에 적합하며, PrEST 항원으로 정제됨. 40% glycerol 기반 PBS buffer에 sodium azide 보존제가 포함됨.

카탈로그번호
HPA021220-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA021220-100 Anti-NUB1 Antibody, negative regulator of ubiquitin-like proteins 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021220-25 Anti-NUB1 Antibody, negative regulator of ubiquitin-like proteins 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NUB1 Antibody

Anti-NUB1 Antibody

Target: Negative regulator of ubiquitin-like proteins 1
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human NUB1.


Alternative Gene Names

  • BS4
  • NYREN18

Open Datasheet


Target Information

항목 내용
Target Protein Negative regulator of ubiquitin-like proteins 1
Target Gene NUB1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000009282 (86%), Mouse ENSMUSG00000028954 (84%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

DNRQESPSQENIDRLVYMGFDALVAEAALRVFRGNVQLAAQTLAHNGGSLPPELPLSPEDSLSPPATSPSDSAGTSSASTDEDMETEAVNEILEDIPEHEEDYLDSTLEDEE


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.