CacheBy
Atlas Antibodies Anti-NTNG1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NTNG1 Antibody

상품 한눈에 보기

인간 NTNG1 단백질을 인식하는 토끼 폴리클로날 항체. 면역형광 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 인간에 대한 반응성이 검증되었으며, 보존성이 높은 마우스 및 랫트 상동체에도 적용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA065954-100 Anti-NTNG1 Antibody, netrin G1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA065954-25 Anti-NTNG1 Antibody, netrin G1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NTNG1 Antibody

Anti-NTNG1 Antibody

Target Information

  • Target Protein: netrin G1
  • Target Gene: NTNG1
  • Alternative Gene Names: KIAA0976, Lmnt1

Product Description

Polyclonal antibody against human NTNG1, raised in rabbit and affinity purified using the PrEST antigen as affinity ligand.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

PYPLVWGHYDLCKTQIYTEEGKVWDYMACQPESTDMTKYLKVKLDPPDITCGD

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000059857 (89%)
  • Rat ENSRNOG00000013694 (49%)

Immunocytochemistry (ICC)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide
Purification Method Affinity purified using the PrEST antigen
Preservative 0.02% sodium azide
Storage Store at -20°C; avoid repeated freeze-thaw cycles

Material Safety Data Sheet (MSDS)

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.