Atlas Antibodies Anti-NTNG1 Antibody

상품 한눈에 보기

인간 NTNG1 단백질을 인식하는 토끼 폴리클로날 항체. 면역형광 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 인간에 대한 반응성이 검증되었으며, 보존성이 높은 마우스 및 랫트 상동체에도 적용 가능.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA065954-100 Anti-NTNG1 Antibody, netrin G1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA065954-25 Anti-NTNG1 Antibody, netrin G1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Polyclonal antibody against human NTNG1, raised in rabbit and affinity purified using the PrEST antigen as affinity ligand.

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

PYPLVWGHYDLCKTQIYTEEGKVWDYMACQPESTDMTKYLKVKLDPPDITCGD

Highest antigen sequence identity to the following orthologs:

Immunocytochemistry (ICC)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2) with 0.02% sodium azide
Purification Method	Affinity purified using the PrEST antigen
Preservative	0.02% sodium azide
Storage	Store at -20°C; avoid repeated freeze-thaw cycles