
Atlas Antibodies Anti-NTRK1 Antibody
상품 한눈에 보기
Human NTRK1 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit 유래 IgG 형식이며 IHC Orthogonal 검증을 완료. Recombinant PrEST 항원을 사용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. Human, Rat, Mouse 반응성 확인.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NTRK1 Antibody
neurotrophic tyrosine kinase, receptor, type 1
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human NTRK1
Alternative Gene Names
MTC, TRK, TRKA
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | neurotrophic tyrosine kinase, receptor, type 1 |
| Target Gene | NTRK1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000013953 (84%), Mouse ENSMUSG00000028072 (82%) |
Antigen Sequence:
KSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQG
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-NTNG1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NTRK2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NTRK1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NTPCR Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NTPCR Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.