CacheBy
Atlas Antibodies Anti-NTPCR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NTPCR Antibody

상품 한눈에 보기

인체 NTPCR 단백질을 표적으로 하는 폴리클로날 항체. Rabbit에서 생산된 IgG 형태로, IHC와 WB에 적합. 고순도 Affinity 정제 방식 적용. Human에 대한 반응성 검증 완료.

카탈로그번호
HPA054304-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA054304-100 Anti-NTPCR Antibody, nucleoside-triphosphatase, cancer-related 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054304-25 Anti-NTPCR Antibody, nucleoside-triphosphatase, cancer-related 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NTPCR Antibody

Anti-NTPCR Antibody

Target: nucleoside-triphosphatase, cancer-related
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human NTPCR.

Alternative Gene Names

C1orf57, HCR-NTPase, MGC13186

Open Datasheet

Target Information

항목 내용
Target Protein nucleoside-triphosphatase, cancer-related
Target Gene NTPCR
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000031851 (82%), Rat ENSRNOG00000019922 (78%)

Antigen Sequence:
LRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPVPKGKPLALVEEIRN

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.