CacheBy
Atlas Antibodies Anti-NTRK2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NTRK2 Antibody

상품 한눈에 보기

인간 NTRK2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC를 통한 단백질 발현 정량에 적합합니다. RNA-seq 데이터와 비교한 정교한 직교 검증을 거쳤으며, 고순도 친화정제 방식으로 제조되었습니다. 다양한 종과의 교차 반응성 정보 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA074873-100 Anti-NTRK2 Antibody, neurotrophic receptor tyrosine kinase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA074873-25 Anti-NTRK2 Antibody, neurotrophic receptor tyrosine kinase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NTRK2 Antibody

Anti-NTRK2 Antibody

Target: neurotrophic receptor tyrosine kinase 2 (NTRK2)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human NTRK2.


Alternative Gene Names

TRKB


Target Information

항목 내용
Target Protein neurotrophic receptor tyrosine kinase 2
Target Gene NTRK2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence INFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCGLPS

Species Reactivity

항목 내용
Verified Reactivity Human
Interspecies Information Highest antigen sequence identity to the following orthologs:
• Rat ENSRNOG00000018839 (92%)
• Mouse ENSMUSG00000055254 (92%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources


제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.