AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-BCL10 Antibody
상품 한눈에 보기
인간 BCL10 단백질을 표적으로 하는 토끼 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. PrEST 항원으로 친화 정제되었으며, RNA-seq 기반 정교한 Orthogonal 검증을 거쳤습니다. 고순도 IgG 형태로 PBS/glycerol 버퍼에 보존되어 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA017925-100 Anti-BCL10 Antibody, B-cell CLL/lymphoma 10 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA017925-25 Anti-BCL10 Antibody, B-cell CLL/lymphoma 10 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-BCL10 Antibody
Anti-BCL10 Antibody
Target: B-cell CLL/lymphoma 10 (BCL10)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human BCL10
Alternative Gene Names
c-E10, CARMEN, CIPER, CLAP, mE10
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | B-cell CLL/lymphoma 10 |
| Target Gene | BCL10 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (97%), Rat (97%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Antigen Sequence
MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTNotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet (MSDS)
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.