CacheBy
Atlas Antibodies Anti-BCKDK Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BCKDK Antibody

상품 한눈에 보기

Human BCKDK 단백질을 인식하는 폴리클로날 항체로, Rabbit host 기반. IHC 및 Western Blot에 적합하며, Human, Mouse, Rat 반응성 검증 완료. Affinity purification으로 높은 특이성과 신뢰도 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056067-100 Anti-BCKDK Antibody, branched chain ketoacid dehydrogenase kinase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056067-25 Anti-BCKDK Antibody, branched chain ketoacid dehydrogenase kinase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BCKDK Antibody

Anti-BCKDK Antibody

Target: Branched Chain Ketoacid Dehydrogenase Kinase (BCKDK)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human BCKDK.

Open Datasheet


Target Information

항목 내용
Target Protein Branched chain ketoacid dehydrogenase kinase
Target Gene BCKDK
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence LLDDHKDVVTLLAEGLRESRKHIEDEKLVRYFLDKTLTSRLGIRMLATHHLALHEDKPDFVGIICTRLSPKKIIEKWVDFARRLCEHKYGNAPRVRINGHVAARFPFIPMPLDY

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000019485 100%
Mouse ENSMUSG00000030802 99%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.