CacheBy
Atlas Antibodies Anti-BCKDK Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BCKDK Antibody

상품 한눈에 보기

Human BCKDK 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC 및 WB 응용에 적합하며, 고순도 Affinity 정제 방식으로 제조되었습니다. Human, Mouse, Rat 종에서 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA017995-100 Anti-BCKDK Antibody, branched chain ketoacid dehydrogenase kinase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA017995-25 Anti-BCKDK Antibody, branched chain ketoacid dehydrogenase kinase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BCKDK Antibody

Anti-BCKDK Antibody

Target: Branched Chain Ketoacid Dehydrogenase Kinase (BCKDK)
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human BCKDK.
Open Datasheet

Target Information

  • Target Protein: Branched Chain Ketoacid Dehydrogenase Kinase
  • Target Gene: BCKDK
  • Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Antigen Sequence:

LLDDHKDVVTLLAEGLRESRKHIEDEKLVRYFLDKTLTSRLGIRMLATHHLALHEDKPDFVGIICTRLSPKKIIEKWVDFARRLCEHKYGNAPRVRINGHVAARFPFIPMPLDY

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000019485 100%
Mouse ENSMUSG00000030802 99%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.