
Atlas Antibodies Anti-BCHE Antibody
상품 한눈에 보기
인간 BCHE 단백질에 특이적인 폴리클로날 항체로, 면역조직화학 등 다양한 연구 응용에 적합합니다. 토끼 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대한 반응성이 검증되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-BCHE Antibody
Target Protein: Butyrylcholinesterase
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human BCHE (butyrylcholinesterase).
Validated for research applications including immunohistochemistry (IHC).
Alternative Gene Names
CHE1, CHE2, E1
Target Information
| 항목 | 내용 |
|---|---|
| Target Gene | BCHE |
| Target Protein | Butyrylcholinesterase |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (78%), Mouse (78%) |
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
QQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAILQSGSFNAPWAVTSLYEARNRTLNLAKLTGCSRENETEIIKCLRNKDPQEILLNEAFVVPYGTPLSVNFGPTVD
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
- Open Datasheet (PDF)
Recommended Applications
- Immunohistochemistry (IHC)
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-BCL11B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BCKDHB Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BCHE Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BCL10 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BCKDK Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.