원본

Thermo Fisher Scientific RAGE Polyclonal Antibody

상품 한눈에 보기

RAGE 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 IHC(P) 실험에 적합합니다. Human, Mouse, Rat 반응성 보유. 항원 친화 크로마토그래피로 정제된 고순도 제품이며, -20°C에서 보관 가능합니다.

카탈로그

1개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

마지막 업데이트 2025. 08. 05. 오후 01:38

카탈로그 번호 · 상품 설명출고판매가담기

Thermo Fisher Scientific PA578736 RAGE Polyclonal Antibody 100 ug pk판매 단위 pk ·

재고 확인 필요재고 확인 필요

568,000원VAT 포함 624,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Application	Tested Dilution
Western Blot (WB)	0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P))	0.5–1 µg/mL

항목	내용
Species Reactivity	Human, Mouse, Rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	A synthetic peptide corresponding to a sequence at the N-terminus of human RAGE (91–120aa IQDEGIFRCQAMNRNGKETKSNYRVRVYQI)
Conjugate	Unconjugated
Form	Lyophilized
Concentration	500 µg/mL
Purification	Antigen affinity chromatography
Storage Buffer	PBS with 5 mg BSA
Contains	0.05 mg sodium azide
Storage Conditions	-20°C
Shipping Conditions	Ambient (domestic); Wet ice (international)
RRID	AB_2745852

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Able to phosphorylate several exogenous substrates and to undergo autophosphorylation.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

(이미지: PA5-78736_RAGE_Q15109-1_Rabbit.svg)
(이미지: PA5-78736_RAGE_Q15109-1_Rabbit_PDP.jpeg)

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.