
Thermo Fisher Scientific RAGE Polyclonal Antibody
상품 한눈에 보기
RAGE 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 IHC(P) 실험에 적합합니다. Human, Mouse, Rat 반응성 보유. 항원 친화 크로마토그래피로 정제된 고순도 제품이며, -20°C에서 보관 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human RAGE (91–120aa IQDEGIFRCQAMNRNGKETKSNYRVRVYQI) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745852 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Able to phosphorylate several exogenous substrates and to undergo autophosphorylation.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지: PA5-78736_RAGE_Q15109-1_Rabbit.svg)
(이미지: PA5-78736_RAGE_Q15109-1_Rabbit_PDP.jpeg)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific AGO2 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific AgRP Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific RAGE Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific Angiotensinogen Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific AFP Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.