Thermo Fisher Scientific AGO2 Polyclonal Antibody
AGO2 단백질을 표적하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody로, 인간·마우스·랫트 시료에 반응합니다. Western blot에 적합하며, 항원 친화 크로마토그래피로 정제되었습니다. miRNA 관련 유전자 침묵 연구에 유용한 연구용 항체입니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Ago2/eIF2C2 (129–169aa KVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745854 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Ago proteins are broadly expressed in somatic cells, associate with miRNAs, and are key actors in different RNA silencing pathways. Only the Ago2 protein displays endonucleolytic or “Slicer” activity and can execute miRNA-directed cleavage of target mRNA when base-pairing is perfect. In cases of partial complementarity, Ago2 interferes with translation via its repression activity.
Ago2 plays a non-redundant role in small RNA-guided gene silencing processes, including RNA interference, translation repression, and heterochromatinization. As a core element of the RISC complex, AGO2 initiates degradation of target mRNAs through catalytic activity guided by siRNAs or miRNAs. It also acts as an RNA slicer in a Dicer-independent manner and regulates miRNA maturation.
Over-expression of Ago2 has been correlated with tumor cell growth and cancer patient survival. Gene disruption in mice demonstrates that Ago2 is essential for embryonic development and regulates B-lymphoid and erythroid development.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 파일: PA5-78738_AGO2_Q9UKV8-1_Rabbit.svg, PA5-78738_AGO2_Q9UKV8-1_Rabbit_PDP.jpeg)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Angiotensinogen Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific AGO1 Polyclonal Antibody
621,000원
Thermo Fisher Scientific
Thermo Fisher Scientific AGO2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific AgRP Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific RAGE Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|