
Thermo Fisher Scientific AGO2 Polyclonal Antibody
AGO2 단백질을 표적하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody로, 인간·마우스·랫트 시료에 반응합니다. Western blot에 적합하며, 항원 친화 크로마토그래피로 정제되었습니다. miRNA 관련 유전자 침묵 연구에 유용한 연구용 항체입니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific AGO2 Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Ago2/eIF2C2 (129–169aa KVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745854 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Ago proteins are broadly expressed in somatic cells, associate with miRNAs, and are key actors in different RNA silencing pathways. Only the Ago2 protein displays endonucleolytic or “Slicer” activity and can execute miRNA-directed cleavage of target mRNA when base-pairing is perfect. In cases of partial complementarity, Ago2 interferes with translation via its repression activity.
Ago2 plays a non-redundant role in small RNA-guided gene silencing processes, including RNA interference, translation repression, and heterochromatinization. As a core element of the RISC complex, AGO2 initiates degradation of target mRNAs through catalytic activity guided by siRNAs or miRNAs. It also acts as an RNA slicer in a Dicer-independent manner and regulates miRNA maturation.
Over-expression of Ago2 has been correlated with tumor cell growth and cancer patient survival. Gene disruption in mice demonstrates that Ago2 is essential for embryonic development and regulates B-lymphoid and erythroid development.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 파일: PA5-78738_AGO2_Q9UKV8-1_Rabbit.svg, PA5-78738_AGO2_Q9UKV8-1_Rabbit_PDP.jpeg)
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
