
Atlas Antibodies Anti-NCAN Antibody
Human NCAN 단백질을 인식하는 폴리클로날 항체로, IHC를 통한 단백질 발현 검증에 적합합니다. Rabbit 호스트에서 생산되었으며, CSPG3 대체 유전자명으로도 알려진 neurocan을 타겟합니다. 고순도 Affinity 정제 방식으로 제조되어 높은 특이성과 재현성을 제공합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NCAN Antibody
Target: neurocan
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human NCAN.
Alternative Gene Names
CSPG3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | neurocan |
| Target Gene | NCAN |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000002341 (81%), Rat ENSRNOG00000048036 (80%) |
Antigen Sequence:
TDASERGLHMQKLGSGSVQAALAELVALPCLFTLQPRPSAARDAPRIKWTKVRTASGQRQDLPILVAKDNVVRVAKSWQGR
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-NCAPD3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NCAPD2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NCAN Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NCAM2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NCAM1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|