CacheBy
Atlas Antibodies Anti-NCAPD2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NCAPD2 Antibody

상품 한눈에 보기

인간 NCAPD2 단백질을 인식하는 폴리클로날 항체입니다. Rabbit 호스트에서 생산되었으며, WB 및 IHC 응용에 적합합니다. Affinity purification을 통해 높은 특이성과 재현성을 제공합니다. CAP-D2, CNAP1 등의 대체 유전자명으로도 알려져 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA037363-100 Anti-NCAPD2 Antibody, non-SMC condensin I complex, subunit D2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037363-25 Anti-NCAPD2 Antibody, non-SMC condensin I complex, subunit D2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NCAPD2 Antibody

Anti-NCAPD2 Antibody

non-SMC condensin I complex, subunit D2

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal Antibody against Human NCAPD2.

Alternative Gene Names

CAP-D2, CNAP1, hCAP-D2, KIAA0159

Open Datasheet

Target Information

항목 내용
Target Protein non-SMC condensin I complex, subunit D2
Target Gene NCAPD2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000055300 (88%), Mouse ENSMUSG00000038252 (87%)

Antigen Sequence (PrEST):
DKSVLVCKNAIQLLASFLANNPFSCKLSDADLAGPLQKETQKLQEMRAQRRTAAASAVLDPEEEWEAMLPELKSTLQQLLQLPQGEEEIPEQIA

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.