Thermo Fisher Scientific SOX10 Polyclonal Antibody
SOX10 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. Western blot, ICC/IF, Flow Cytometry에 적합. 인간, 마우스, 랫트 반응성. 항원 친화 크로마토그래피로 정제된 고순도 항체로 연구용에 적합.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunocytochemistry (ICC/IF) | 1:100 |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human SOX10 (KPHIDFGNVDIGEISHEVMSNMETFDVAELDQYL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2747168 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
SOX10 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate.
This protein may act as a transcriptional activator after forming a protein complex with other proteins.
It acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development.
Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific SOX3 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SOD3 Polyclonal Antibody
668,200원
Thermo Fisher Scientific
Thermo Fisher Scientific SOX10 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SOD3 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SOD2 (MnSOD) Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|