원본
Thermo Fisher Scientific alpha Actinin 3 Polyclonal Antibody, DyLight 488
상품 한눈에 보기
Rabbit polyclonal antibody conjugated with DyLight 488 for detection of human alpha Actinin 3. Optimized for flow cytometry. High specificity and affinity purified. Suitable for skeletal muscle protein research.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오후 07:46
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA578719 alpha Actinin 3 Polyclonal Antibody, DyLight 488 100 ug pk판매 단위 pk ·
재고 확인 필요
661,800원VAT 포함 727,980원
Thermo Fisher Scientific · Thermo Fisher Scientific alpha Actinin 3 Polyclonal Antibody, DyLight 488
Applications
- Flow Cytometry (Flow): 1–3 µg/1×10⁶ cells
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminus of human ACTN3 (574–617 aa: EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINT K) |
| Conjugate | DyLight™ 488 |
| Excitation / Emission Max | 492 / 519 nm |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 50% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | -20°C, avoid freeze/thaw cycles, store in dark |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745835 |
Target Information
Alpha-actinin-3 (also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein) is encoded by the ACTN3 gene in humans. This protein is a structural component of the sarcomeric Z line in skeletal muscle and is involved in crosslinking actin-containing thin filaments. Variations in this gene include both coding and non-coding alleles; the reference genome represents the coding allele.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific Actin Polyclonal Antibody555,300원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Actin Polyclonal Antibody556,200원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific alpha Actinin 3 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific ATP Citrate Lyase Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.