Thermo Fisher Scientific alpha Actinin 3 Polyclonal Antibody, DyLight 488
Rabbit polyclonal antibody conjugated with DyLight 488 for detection of human alpha Actinin 3. Optimized for flow cytometry. High specificity and affinity purified. Suitable for skeletal muscle protein research.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
- Flow Cytometry (Flow): 1–3 µg/1×10⁶ cells
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminus of human ACTN3 (574–617 aa: EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINT K) |
| Conjugate | DyLight™ 488 |
| Excitation / Emission Max | 492 / 519 nm |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 50% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | -20°C, avoid freeze/thaw cycles, store in dark |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745835 |
Target Information
Alpha-actinin-3 (also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein) is encoded by the ACTN3 gene in humans. This protein is a structural component of the sarcomeric Z line in skeletal muscle and is involved in crosslinking actin-containing thin filaments. Variations in this gene include both coding and non-coding alleles; the reference genome represents the coding allele.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Actin Polyclonal Antibody
555,300원
Thermo Fisher Scientific
Thermo Fisher Scientific Actin Polyclonal Antibody
556,200원
Thermo Fisher Scientific
Thermo Fisher Scientific alpha Actinin 3 Polyclonal Antibody, DyLight 488
661,800원
Thermo Fisher Scientific
Thermo Fisher Scientific alpha Actinin 3 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ATP Citrate Lyase Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|