Thermo Fisher Scientific alpha Actinin 3 Polyclonal Antibody
Alpha Actinin 3 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody로, Western Blot, IHC, Flow Cytometry에 적합합니다. Human, Mouse, Rat 반응성을 가지며 항원 친화 크로마토그래피로 정제되었습니다. 연구용으로만 사용됩니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific alpha Actinin 3 Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Property | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human ACTN3 (574–617aa: EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745836 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Alpha-actinin-3 (ACTN3) is a skeletal muscle isoform of alpha-actinin, encoded by the ACTN3 gene. It functions as a structural component of the sarcomeric Z line and crosslinks actin-containing thin filaments. This protein is primarily expressed in skeletal muscle. An allelic polymorphism in ACTN3 results in both coding and non-coding variants; the reference genome represents the coding allele.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.