Thermo Fisher Scientific HO-1 Polyclonal Antibody
HO-1 단백질을 인식하는 Thermo Fisher Scientific의 토끼 폴리클로날 항체. Western blot, IHC, ICC 등 다양한 응용에 적합. 단백질 A로 정제된 액상 형태로, -20°C에서 보관. 산화 스트레스 관련 연구에 유용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 1:1,000 | View 9 publications |
| Immunohistochemistry (IHC) | - | View 1 publication |
| Immunohistochemistry (PFA fixed) (IHC (PFA)) | 1:100 | - |
| Immunocytochemistry (ICC/IF) | 1:100 | - |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Dog, Human, Mouse, Rat |
| Published Species | Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Human heme-oxygenase (HO-1) synthetic multiple antigenic peptide (aa. 1–30): MERPQPDSMPQDLSEALKEATKEVHTQAEN |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 1 mg/mL |
| Purification | Protein A |
| Storage Buffer | PBS, pH 7.4, with 50% glycerol |
| Contains | 0.09% sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2735912 |
Product Specific Information
1 µg/mL of PA5-77833 was sufficient for detection of HO-1 in 10 µg of heat-shocked HeLa cell lysate by colorimetric immunoblot analysis using Goat anti-rabbit IgG:HRP as the secondary antibody. Detects approximately 32 kDa.
Target Information
Heme oxygenase (HO) is a microsomal enzyme that catalyzes the oxidation of heme to the antioxidant molecules biliverdin and carbon monoxide. HO consists of two homologous isozymes: inducible HO-1 and constitutively expressed HO-2.
HO-1 is induced by various stimuli including oxidative stress, inflammatory agents, transforming growth factor beta, and heat shock. Increased expression of HO-1 is thought to be a cellular defense mechanism against oxidative stress, as elevated HO can generate more bilirubin, an antioxidant.
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific ChAT Polyclonal Antibody
775,200원
Thermo Fisher Scientific
Thermo Fisher Scientific CRYAB Polyclonal Antibody
796,700원
Thermo Fisher Scientific
Thermo Fisher Scientific HO-1 Polyclonal Antibody
775,200원
Thermo Fisher Scientific
Thermo Fisher Scientific HO-1 Polyclonal Antibody
775,200원
Thermo Fisher Scientific
Thermo Fisher Scientific HSPB8 Polyclonal Antibody
775,200원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|