Thermo Fisher Scientific HO-1 Polyclonal Antibody
HO-1 단백질을 인식하는 Thermo Fisher Scientific의 토끼 폴리클로날 항체. Western blot, IHC, ICC 등 다양한 응용에 적합. 단백질 A로 정제된 액상 형태로, -20°C에서 보관. 산화 스트레스 관련 연구에 유용.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific HO-1 Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 1:1,000 | View 9 publications |
| Immunohistochemistry (IHC) | - | View 1 publication |
| Immunohistochemistry (PFA fixed) (IHC (PFA)) | 1:100 | - |
| Immunocytochemistry (ICC/IF) | 1:100 | - |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Dog, Human, Mouse, Rat |
| Published Species | Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Human heme-oxygenase (HO-1) synthetic multiple antigenic peptide (aa. 1–30): MERPQPDSMPQDLSEALKEATKEVHTQAEN |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 1 mg/mL |
| Purification | Protein A |
| Storage Buffer | PBS, pH 7.4, with 50% glycerol |
| Contains | 0.09% sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2735912 |
Product Specific Information
1 µg/mL of PA5-77833 was sufficient for detection of HO-1 in 10 µg of heat-shocked HeLa cell lysate by colorimetric immunoblot analysis using Goat anti-rabbit IgG:HRP as the secondary antibody. Detects approximately 32 kDa.
Target Information
Heme oxygenase (HO) is a microsomal enzyme that catalyzes the oxidation of heme to the antioxidant molecules biliverdin and carbon monoxide. HO consists of two homologous isozymes: inducible HO-1 and constitutively expressed HO-2.
HO-1 is induced by various stimuli including oxidative stress, inflammatory agents, transforming growth factor beta, and heat shock. Increased expression of HO-1 is thought to be a cellular defense mechanism against oxidative stress, as elevated HO can generate more bilirubin, an antioxidant.
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.