Atlas Antibodies Anti-AQP8 Antibody

상품 한눈에 보기

Human AQP8 단백질을 인식하는 rabbit polyclonal 항체로, IHC에서 RNA-seq 데이터 비교를 통한 orthogonal validation 완료. PrEST 항원을 이용해 친화 정제되었으며, PBS/glycerol buffer에 보존. 다양한 조직 발현 연구에 적합.

카탈로그번호: HPA046259-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA046259-100 Anti-AQP8 Antibody, aquaporin 8 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA046259-25 Anti-AQP8 Antibody, aquaporin 8 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-AQP8 Antibody

Anti-AQP8 Antibody

Target: aquaporin 8 (AQP8)
Type: Polyclonal Antibody against Human AQP8

Recommended Applications

Orthogonal validation of protein expression using IHC
RNA-seq 데이터와 비교하여 고/저 발현 조직에서 단백질 발현을 검증함.

Product Description

Polyclonal antibody raised in rabbit against human AQP8.
Validated through enhanced and orthogonal validation methods.
Open Datasheet (PDF)

Specifications

항목	내용
Target Protein	aquaporin 8
Target Gene	AQP8
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	EIAMCEPEFGNDKAREPSVGGRWRVSWYERF
Verified Species Reactivity	Human
Interspecies Homology	Mouse (39%), Rat (35%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method	Affinity purified using PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.