Atlas Antibodies Anti-AQP8 Antibody
상품 한눈에 보기
Human AQP8 단백질을 인식하는 rabbit polyclonal 항체로, IHC에서 RNA-seq 데이터 비교를 통한 orthogonal validation 완료. PrEST 항원을 이용해 친화 정제되었으며, PBS/glycerol buffer에 보존. 다양한 조직 발현 연구에 적합.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-AQP8 Antibody
Target: aquaporin 8 (AQP8)
Type: Polyclonal Antibody against Human AQP8
Recommended Applications
- Orthogonal validation of protein expression using IHC
RNA-seq 데이터와 비교하여 고/저 발현 조직에서 단백질 발현을 검증함.
Product Description
Polyclonal antibody raised in rabbit against human AQP8.
Validated through enhanced and orthogonal validation methods.
Open Datasheet (PDF)
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | aquaporin 8 |
| Target Gene | AQP8 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | EIAMCEPEFGNDKAREPSVGGRWRVSWYERF |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse (39%), Rat (35%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.