
Atlas Antibodies Anti-AQP5 Antibody
상품 한눈에 보기
휴먼 AQP5 단백질을 타깃으로 하는 폴리클로날 항체로, IHC 및 ICC 등 다양한 응용에 적합합니다. 정제된 PrEST 항원을 사용하여 제작되었으며, 정제도와 특이성이 높습니다. 토끼 유래 IgG 항체로 인간에 대한 반응성이 검증되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-AQP5 Antibody
Target: aquaporin 5 (AQP5)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in tissues with high and low expression.
- ICC
Product Description
Polyclonal antibody against human AQP5.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | aquaporin 5 |
| Target Gene | AQP5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | SLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTT |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000044217 (75%), Rat ENSRNOG00000051970 (75%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
