Atlas Antibodies Anti-AQP6 Antibody

상품 한눈에 보기

Human AQP6 단백질을 표적으로 하는 토끼 유래 폴리클로날 항체. IHC 및 RNA-seq 비교를 통한 정교한 단백질 발현 검증 제공. Kidney-specific aquaporin 연구에 적합. PrEST 항원으로 친화 정제된 고품질 항체.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA015278-100 Anti-AQP6 Antibody, aquaporin 6, kidney specific 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA015278-25 Anti-AQP6 Antibody, aquaporin 6, kidney specific 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: aquaporin 6, kidney specific
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal antibody against human AQP6.

AQP2L

항목	내용
Target Protein	aquaporin 6, kidney specific
Target Gene	AQP6
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000043144 (55%) Rat ENSRNOG00000053181 (55%)

Antigen sequence:
PDTKTLAQRLAILTGTVEVGTGAGAGAEPLKKESQPGSGAVEME

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand