Atlas Antibodies Anti-AQP2 Antibody

상품 한눈에 보기

Human AQP2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 RNA-seq 데이터 기반 Orthogonal 검증 완료. 고순도의 Affinity 정제 방식 적용. 인간, 쥐, 랫드 간 교차 반응성 확인됨. PBS/glycerol buffer로 안정화된 제품.

카탈로그번호: HPA046834-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Primary Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA046834-100 Anti-AQP2 Antibody, aquaporin 2 (collecting duct) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA046834-25 Anti-AQP2 Antibody, aquaporin 2 (collecting duct) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-AQP2 Antibody

Anti-AQP2 Antibody

Target: aquaporin 2 (collecting duct)
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against Human AQP2.
Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	aquaporin 2 (collecting duct)
Target Gene	AQP2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: VLFPPAKSLSERLAVLKGLEPDTDWEEREVRRRQSVELHSPQSL
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000054378 (93%) Mouse ENSMUSG00000023013 (91%)