CacheBy
Atlas Antibodies Anti-AQP12A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-AQP12A Antibody

상품 한눈에 보기

Human AQP12A 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, PBS와 글리세롤 버퍼에 보존됩니다. 인간에 특이적으로 반응하며 AQP12A 연구에 유용합니다.

카탈로그번호
HPA042216-xxx (2개 옵션)
카테고리
Primary Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042216-100 Anti-AQP12A Antibody, aquaporin 12A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042216-25 Anti-AQP12A Antibody, aquaporin 12A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-AQP12A Antibody

Anti-AQP12A Antibody

Target Information

  • Target Protein: aquaporin 12A
  • Target Gene: AQP12A
  • Alternative Gene Names: AQP12

Product Description

Polyclonal Antibody against Human AQP12A

  • Immunohistochemistry (IHC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

FQRNLFYGQKNKYRAPRGKPAPASGDTQTPAKGSSVREPGRSGVE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Mouse ENSMUSG00000045091 42%
Rat ENSRNOG00000004452 40%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.