
원본
Thermo Fisher Scientific AGO1 Polyclonal Antibody
상품 한눈에 보기
AGO1 단백질을 인식하는 Rabbit Polyclonal 항체로, WB, IHC, ICC, Flow Cytometry에 사용 가능. 합성 펩타이드 면역원 기반으로 제작되었으며, 동결건조 형태로 제공. 재구성 시 500 µg/mL 농도로 사용 가능. 연구용으로만 사용.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오전 03:59
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA578737 AGO1 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
621,000원VAT 포함 683,100원
Thermo Fisher Scientific · Thermo Fisher Scientific AGO1 Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human EIF2C1/AGO1 (376–409aa EISRLMKNASYNLDPYIQEFGIKVKDDMTEVTGR) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2745853 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
AGO1 is a member of the Argonaute family of proteins which play a role in RNA interference. The protein is highly basic and contains a PAZ domain and a PIWI domain. It may interact with Dicer1 and play a role in short-interfering-RNA-mediated gene silencing. AGO1 binds to miRNAs or siRNAs and represses the translation of mRNAs.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
