
Thermo Fisher Scientific CD26 Polyclonal Antibody
CD26 단백질을 인식하는 Thermo Fisher Scientific의 폴리클로날 항체로, WB 및 ICC/IF에 적합합니다. 인간, 마우스, 랫트 반응성이 있으며, 항원 친화 크로마토그래피로 정제되었습니다. T세포 활성화 및 면역학 연구에 활용됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Immunocytochemistry (ICC/IF)
- Tested Dilution: 5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host/Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human CD26 (731–761aa QAMWYTDEDHGIASSTAHQHIYTHMSHFIKQ) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746281 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
CD26 (dipeptidyl peptidase IV, DPP IV, adenosine deaminase binding protein) is a homodimeric atypical serine protease belonging to the prolyl oligopeptidase family.
CD26 is expressed on lymphocytes and upregulated during T-cell activation. It is also found on activated B cells, natural killer cells, and epithelial tissues.
CD26 participates in T-cell activation, cell adhesion to extracellular matrix components such as fibronectin and collagen, and HIV infection.
It is identical to adenosine deaminase complexing protein-2 and functions as a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides.
Alterations in CD26 peptidase activity are associated with malignant transformation, with activity increasing with tumor grade and severity.
Changes in CD26 density have been observed on circulating monocytes and CD4+ T cells in rheumatoid arthritis and systemic lupus erythematosus.
For Research Use Only. Not for use in diagnostic procedures or resale without authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific Desmoglein 2 (DSG2) Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific DPYD Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific CD26 Polyclonal Antibody
668,200원

Thermo Fisher Scientific
Thermo Fisher Scientific TdT Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific DPT Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|