CacheBy
Thermo Fisher Scientific CD26 Polyclonal Antibody
원본

Thermo Fisher Scientific CD26 Polyclonal Antibody

상품 한눈에 보기

CD26 단백질을 인식하는 Thermo Fisher Scientific의 폴리클로날 항체로, WB 및 ICC/IF에 적합합니다. 인간, 마우스, 랫트 반응성이 있으며, 항원 친화 크로마토그래피로 정제되었습니다. T세포 활성화 및 면역학 연구에 활용됩니다.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 07. 27. 오전 04:15
Thermo Fisher Scientific PA579165 CD26 Polyclonal Antibody 100 ug pk판매 단위 pk
재고 1개
668,200원VAT 포함 735,020원

Thermo Fisher Scientific · Thermo Fisher Scientific CD26 Polyclonal Antibody

Applications

Western Blot (WB)

  • Tested Dilution: 0.1–0.5 µg/mL

Immunocytochemistry (ICC/IF)

  • Tested Dilution: 5 µg/mL

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Host/Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human CD26 (731–761aa QAMWYTDEDHGIASSTAHQHIYTHMSHFIKQ)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage buffer PBS with 5 mg BSA
Contains 0.05 mg sodium azide
Storage conditions -20°C
Shipping conditions Ambient (domestic); Wet ice (international)
RRID AB_2746281

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

CD26 (dipeptidyl peptidase IV, DPP IV, adenosine deaminase binding protein) is a homodimeric atypical serine protease belonging to the prolyl oligopeptidase family.
CD26 is expressed on lymphocytes and upregulated during T-cell activation. It is also found on activated B cells, natural killer cells, and epithelial tissues.
CD26 participates in T-cell activation, cell adhesion to extracellular matrix components such as fibronectin and collagen, and HIV infection.
It is identical to adenosine deaminase complexing protein-2 and functions as a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides.
Alterations in CD26 peptidase activity are associated with malignant transformation, with activity increasing with tumor grade and severity.
Changes in CD26 density have been observed on circulating monocytes and CD4+ T cells in rheumatoid arthritis and systemic lupus erythematosus.

For Research Use Only. Not for use in diagnostic procedures or resale without authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.