원본
Thermo Fisher Scientific EGFR Recombinant Rabbit Monoclonal Antibody (ARC1139)
상품 한눈에 보기
EGFR 단백질을 표적하는 재조합 토끼 단클론 항체로, Western Blot, IHC, ELISA 등에 적합합니다. 인간 및 마우스 반응성이 있으며, 고순도 친화 크로마토그래피로 정제되었습니다. 액상 형태로 제공되며 안정적인 저장이 가능합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오전 06:52
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific MA535626 EGFR Recombinant Rabbit Monoclonal Antibody (ARC1139) 100 ul pk판매 단위 pk ·
재고 확인 필요
598,300원VAT 포함 658,130원
Thermo Fisher Scientific · Thermo Fisher Scientific EGFR Recombinant Rabbit Monoclonal Antibody (ARC1139)
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:2,000 |
| Immunohistochemistry (Paraffin) (IHC-P) | 1:50–1:200 |
| ELISA | 1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse |
| Host / Isotype | Rabbit / IgG |
| Expression System | HEK293 cells |
| Class | Recombinant Monoclonal |
| Type | Antibody |
| Clone | ARC1139 |
| Immunogen | Synthetic peptide corresponding to amino acids 800–900 of human EGFR (L858R) (UniProt: P00533) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 2 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS, pH 7.3, with 50% glycerol, 0.05% BSA |
| Contains | 0.02% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2849526 |
Product Specific Information
Immunogen sequence:
DYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
Target Information
EGFR (Epidermal Growth Factor Receptor)는 다양한 성장인자에 반응하는 수용체 티로신 키나아제로, 여러 종류의 암에서 과발현되는 것으로 알려져 있습니다. EGFR은 인간의 7번 염색체에 위치한 EGFR 유전자에 의해 암호화되며, HER/ERbB 단백질군에 속합니다. EGF 및 TGF-α와 같은 리간드가 결합하면 수용체 이합체화 및 세포 내 도메인에서 티로신 잔기의 자동 인산화가 일어납니다.
과발현은 두경부, 뇌, 방광, 위, 유방, 폐, 자궁내막, 자궁경부, 외음부, 난소, 식도 및 편평세포암종 등 다양한 종양에서 관찰됩니다.
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific CAF1 p60 Recombinant Rabbit Monoclonal Antibody (ARC1269)598,300원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific PSME1 Recombinant Rabbit Monoclonal Antibody (ARC1254)598,300원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Furin Recombinant Rabbit Monoclonal Antibody (ARC1221)598,300원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific JNK1/JNK3 Recombinant Rabbit Monoclonal Antibody (ARC1163)598,300원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.