Thermo Fisher Scientific ETV4 Polyclonal Antibody
ETV4 단백질을 인식하는 Thermo Fisher Scientific의 rabbit polyclonal antibody입니다. Western blot에 적합하며, 인간 및 랫트 시료에서 반응합니다. 항원 친화 크로마토그래피로 정제되었고, 동결건조 형태로 제공됩니다. 연구용으로만 사용 가능합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific ETV4 Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence at the N-terminus of human Pea3 (1–41 aa: MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMD) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746339 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
ETV4 (E1A enhancer binding protein, E1AF)
Also known as PEA3. Members of the Ets gene family encode sequence-specific DNA binding proteins (e.g., PU.1, Ets-1, Ets-2, GABP-α).
These proteins recognize motifs containing a central 5'-GGAA-3' element.
PEA3 binds the motif 5'-AGGAAG-3' but not 5'-AGGAAC-3', showing unique flanking sequence specificity.
PEA3 is expressed in epithelial and fibroblastic cells, but not in hematopoietic cells, unlike Ets-1, Ets-2, and Fli-1.
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.