
Thermo Fisher Scientific ETV4 Polyclonal Antibody
ETV4 단백질을 인식하는 Thermo Fisher Scientific의 rabbit polyclonal antibody입니다. Western blot에 적합하며, 인간 및 랫트 시료에서 반응합니다. 항원 친화 크로마토그래피로 정제되었고, 동결건조 형태로 제공됩니다. 연구용으로만 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence at the N-terminus of human Pea3 (1–41 aa: MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMD) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746339 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
ETV4 (E1A enhancer binding protein, E1AF)
Also known as PEA3. Members of the Ets gene family encode sequence-specific DNA binding proteins (e.g., PU.1, Ets-1, Ets-2, GABP-α).
These proteins recognize motifs containing a central 5'-GGAA-3' element.
PEA3 binds the motif 5'-AGGAAG-3' but not 5'-AGGAAC-3', showing unique flanking sequence specificity.
PEA3 is expressed in epithelial and fibroblastic cells, but not in hematopoietic cells, unlike Ets-1, Ets-2, and Fli-1.
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
제품 이미지
(이미지 없음)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific ETS1 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific Endocan Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific ETV4 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific HERV Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific ERV3 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|