
Thermo Fisher Scientific ETS1 Polyclonal Antibody
ETS1 단백질을 인식하는 Thermo Fisher Scientific의 폴리클로날 항체로, 인간 및 생쥐 시료에 반응합니다. Western blot에 최적화되어 있으며, 항원 친화 크로마토그래피로 정제되었습니다. 연구용으로만 사용되며 -20°C에서 보관합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific ETS1 Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ETS1 (67–98aa KDPRQWTETHVRDWVMWAVNEFSLKGVDFQKF) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746338 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
ETS1 (c-Ets-1; v-ets erythroblastosis virus E26 oncogene homolog 1 (avian); ETS-1; EWSR2; p54) is a 441 amino acid protein belonging to the DNA-binding ETS family.
It consists of:
- N-terminal pointed domain
- Central transactivation domain
- Two auto-inhibitory domains flanked by conserved C-terminal ETS domain
ETS1 interacts with factors such as PEBP2alphaA and p300/CBP, mediating transactivation of Osteopontin, Presenilin-1, Stromelysin, and Collagenase.
Activated by Ras/MAPK signaling, its expression increases in resting T-cells.
Activity is modulated by AP-1, Sp-1, c-myb, and MafB.
Sp100 activates ETS1 in nuclear bodies.
Interacts with EAP1/Daxx (represses MMP1 and BCL2 transactivation), STAT6 (modulates Socs-1 expression induced by IL-4), and GATA3 (positively regulates Tax-1 dependent IL-5 expression).
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
제품 이미지

Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
