
Thermo Fisher Scientific ETS1 Polyclonal Antibody
ETS1 단백질을 인식하는 Thermo Fisher Scientific의 폴리클로날 항체로, 인간 및 생쥐 시료에 반응합니다. Western blot에 최적화되어 있으며, 항원 친화 크로마토그래피로 정제되었습니다. 연구용으로만 사용되며 -20°C에서 보관합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ETS1 (67–98aa KDPRQWTETHVRDWVMWAVNEFSLKGVDFQKF) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746338 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
ETS1 (c-Ets-1; v-ets erythroblastosis virus E26 oncogene homolog 1 (avian); ETS-1; EWSR2; p54) is a 441 amino acid protein belonging to the DNA-binding ETS family.
It consists of:
- N-terminal pointed domain
- Central transactivation domain
- Two auto-inhibitory domains flanked by conserved C-terminal ETS domain
ETS1 interacts with factors such as PEBP2alphaA and p300/CBP, mediating transactivation of Osteopontin, Presenilin-1, Stromelysin, and Collagenase.
Activated by Ras/MAPK signaling, its expression increases in resting T-cells.
Activity is modulated by AP-1, Sp-1, c-myb, and MafB.
Sp100 activates ETS1 in nuclear bodies.
Interacts with EAP1/Daxx (represses MMP1 and BCL2 transactivation), STAT6 (modulates Socs-1 expression induced by IL-4), and GATA3 (positively regulates Tax-1 dependent IL-5 expression).
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
제품 이미지

🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific CD142 Polyclonal Antibody
544,000원

Thermo Fisher Scientific
Thermo Fisher Scientific ETV6 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific ETS1 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific Endocan Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific ETV4 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|