CacheBy
Thermo Fisher Scientific ETS1 Polyclonal Antibody
원본

Thermo Fisher Scientific ETS1 Polyclonal Antibody

상품 한눈에 보기

ETS1 단백질을 인식하는 Thermo Fisher Scientific의 폴리클로날 항체로, 인간 및 생쥐 시료에 반응합니다. Western blot에 최적화되어 있으며, 항원 친화 크로마토그래피로 정제되었습니다. 연구용으로만 사용되며 -20°C에서 보관합니다.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 09:46
Thermo Fisher Scientific PA579222 ETS1 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific ETS1 Polyclonal Antibody

Applications

Western Blot (WB)

  • Tested Dilution: 0.1–0.5 µg/mL

Product Specifications

항목 내용
Species Reactivity Human, Mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human ETS1 (67–98aa KDPRQWTETHVRDWVMWAVNEFSLKGVDFQKF)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 4 mg trehalose
Contains 0.05 mg sodium azide
Storage Conditions -20°C
Shipping Conditions Wet ice
RRID AB_2746338

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.


Target Information

ETS1 (c-Ets-1; v-ets erythroblastosis virus E26 oncogene homolog 1 (avian); ETS-1; EWSR2; p54) is a 441 amino acid protein belonging to the DNA-binding ETS family.
It consists of:

  • N-terminal pointed domain
  • Central transactivation domain
  • Two auto-inhibitory domains flanked by conserved C-terminal ETS domain

ETS1 interacts with factors such as PEBP2alphaA and p300/CBP, mediating transactivation of Osteopontin, Presenilin-1, Stromelysin, and Collagenase.
Activated by Ras/MAPK signaling, its expression increases in resting T-cells.
Activity is modulated by AP-1, Sp-1, c-myb, and MafB.
Sp100 activates ETS1 in nuclear bodies.
Interacts with EAP1/Daxx (represses MMP1 and BCL2 transactivation), STAT6 (modulates Socs-1 expression induced by IL-4), and GATA3 (positively regulates Tax-1 dependent IL-5 expression).


For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.


제품 이미지

ETS1 Antigen Structure
ETS1 Antigen PDP

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.