Thermo Fisher Scientific ERV3 Polyclonal Antibody
인간 ERV3 단백질을 인식하는 폴리클로날 항체로, Western blot에 적합합니다. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공됩니다. 재구성 시 500 µg/mL 농도로 사용 가능하며, 연구용으로만 사용됩니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific ERV3 Polyclonal Antibody
Thermo Fisher Scientific ERV3 Polyclonal Antibody
Applications
- Western Blot (WB)
Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human ERV31 (575–604aa LELDDEGKVIKEITAKIQKLAHIPVQTWKG) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746335 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Retroviral envelope proteins mediate receptor recognition and membrane fusion during early infection.
Endogenous envelope proteins may have kept, lost, or modified their original function during evolution.
This endogenous envelope protein has lost its fusogenic properties. It can inhibit cell growth through decreased expression of cyclin B1 and increased expression of p21 in vitro.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 파일명: PA5-79219_ERV3_Q14264-1_Rabbit.svg, PA5-79219_ERV3_Q14264-1_Rabbit_PDP.jpeg)
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.