Thermo Fisher Scientific ERV3 Polyclonal Antibody
인간 ERV3 단백질을 인식하는 폴리클로날 항체로, Western blot에 적합합니다. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공됩니다. 재구성 시 500 µg/mL 농도로 사용 가능하며, 연구용으로만 사용됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific ERV3 Polyclonal Antibody
Applications
- Western Blot (WB)
Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human ERV31 (575–604aa LELDDEGKVIKEITAKIQKLAHIPVQTWKG) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746335 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Retroviral envelope proteins mediate receptor recognition and membrane fusion during early infection.
Endogenous envelope proteins may have kept, lost, or modified their original function during evolution.
This endogenous envelope protein has lost its fusogenic properties. It can inhibit cell growth through decreased expression of cyclin B1 and increased expression of p21 in vitro.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 파일명: PA5-79219_ERV3_Q14264-1_Rabbit.svg, PA5-79219_ERV3_Q14264-1_Rabbit_PDP.jpeg)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific ETV4 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific HERV Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ERV3 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific CSB Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific EpoR Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|