CacheBy
Thermo Fisher Scientific CaV1.2a (CACNA1C) Polyclonal Antibody
원본

Thermo Fisher Scientific CaV1.2a (CACNA1C) Polyclonal Antibody

상품 한눈에 보기

CaV1.2a(CACNA1C) 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 IHC에 사용 가능. 항원 친화 크로마토그래피로 정제되었으며, 동결 건조 형태로 제공. 인간, 생쥐, 토끼, 랫트 반응성. 연구용으로만 사용.

판매단위
pk
카탈로그 보기

카탈로그

3개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 04:59
Thermo Fisher Scientific ACC-013-200UL CaV1.2a (CACNA1C) Polyclonal Antibody 200 ul pk판매 단위 pk ·
재고 확인 필요
1,121,200원VAT 포함 1,233,320원
Thermo Fisher Scientific ACC-013-50UL CaV1.2a (CACNA1C) Polyclonal Antibody 50 ul pk판매 단위 pk ·
재고 확인 필요
923,800원VAT 포함 1,016,180원
Thermo Fisher Scientific ACC-013-25UL CaV1.2a (CACNA1C) Polyclonal Antibody 25 ul pk판매 단위 pk ·
재고 확인 필요
742,000원VAT 포함 816,200원

Thermo Fisher Scientific · Thermo Fisher Scientific CaV1.2a (CACNA1C) Polyclonal Antibody

Applications

Western Blot (WB)

  • Tested Dilution: 1:200

Immunohistochemistry (IHC)

  • Tested Dilution: Assay-dependent

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rabbit, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen GST fusion protein with sequence MLRALVQPATPAYQPLPSHLSAETESTCKGTVVHEAQLNHFYISPG (amino acids 1–46 of rabbit CaV1.2a, serine 44 replaced with alanine), intracellular, N-terminus
Conjugate Unconjugated
Form Lyophilized
Concentration 0.95 mg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS, pH 7.4, with 1% BSA
Contains 0.05% sodium azide
Storage Conditions -20°C, Avoid Freeze/Thaw Cycles
Shipping Conditions Ambient (domestic); Wet ice (international)

Product Specific Information

  • Reconstitution: Add 25 µL, 50 µL, or 0.2 mL double distilled water (DDW) depending on sample size.
  • Ships as lyophilized powder at room temperature; store at -20°C upon arrival.
  • Reconstituted solution can be stored at 4°C for up to 1 week; for longer storage, aliquot and keep at -20°C.
  • Avoid repeated freeze/thaw cycles.
  • Centrifuge all antibody preparations before use (10,000 × g, 5 min).

Target Information

CACNA1C encodes the alpha-1 subunit of a voltage-dependent calcium channel.
Calcium channels mediate calcium ion influx upon membrane polarization.
The alpha-1 subunit has 24 transmembrane segments and forms the ion-conducting pore.
The functional channel complex includes alpha-1, alpha-2/delta, beta, and gamma subunits (1:1:1:1 ratio).
Multiple isoforms arise from distinct genes or alternative splicing events.
The CACNA1C protein binds to and is inhibited by dihydropyridine.
Alternative splicing produces diverse transcript variants encoding different proteins.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

(이미지 없음)

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.