
Thermo Fisher Scientific CaV1.2a (CACNA1C) Polyclonal Antibody
CaV1.2a(CACNA1C) 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 IHC에 사용 가능. 항원 친화 크로마토그래피로 정제되었으며, 동결 건조 형태로 제공. 인간, 생쥐, 토끼, 랫트 반응성. 연구용으로만 사용.
- 카탈로그번호
- ACC-013-xxxxx (3개 옵션)
- 판매단위
- pk
카탈로그
3개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific CaV1.2a (CACNA1C) Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 1:200
Immunohistochemistry (IHC)
- Tested Dilution: Assay-dependent
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rabbit, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | GST fusion protein with sequence MLRALVQPATPAYQPLPSHLSAETESTCKGTVVHEAQLNHFYISPG (amino acids 1–46 of rabbit CaV1.2a, serine 44 replaced with alanine), intracellular, N-terminus |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 0.95 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.4, with 1% BSA |
| Contains | 0.05% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Product Specific Information
- Reconstitution: Add 25 µL, 50 µL, or 0.2 mL double distilled water (DDW) depending on sample size.
- Ships as lyophilized powder at room temperature; store at -20°C upon arrival.
- Reconstituted solution can be stored at 4°C for up to 1 week; for longer storage, aliquot and keep at -20°C.
- Avoid repeated freeze/thaw cycles.
- Centrifuge all antibody preparations before use (10,000 × g, 5 min).
Target Information
CACNA1C encodes the alpha-1 subunit of a voltage-dependent calcium channel.
Calcium channels mediate calcium ion influx upon membrane polarization.
The alpha-1 subunit has 24 transmembrane segments and forms the ion-conducting pore.
The functional channel complex includes alpha-1, alpha-2/delta, beta, and gamma subunits (1:1:1:1 ratio).
Multiple isoforms arise from distinct genes or alternative splicing events.
The CACNA1C protein binds to and is inhibited by dihydropyridine.
Alternative splicing produces diverse transcript variants encoding different proteins.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
