
Thermo Fisher Scientific CaV1.2a (CACNA1C) Polyclonal Antibody
CaV1.2a(CACNA1C) 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 IHC에 사용 가능. 항원 친화 크로마토그래피로 정제되었으며, 동결 건조 형태로 제공. 인간, 생쥐, 토끼, 랫트 반응성. 연구용으로만 사용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 1:200
Immunohistochemistry (IHC)
- Tested Dilution: Assay-dependent
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rabbit, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | GST fusion protein with sequence MLRALVQPATPAYQPLPSHLSAETESTCKGTVVHEAQLNHFYISPG (amino acids 1–46 of rabbit CaV1.2a, serine 44 replaced with alanine), intracellular, N-terminus |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 0.95 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.4, with 1% BSA |
| Contains | 0.05% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Product Specific Information
- Reconstitution: Add 25 µL, 50 µL, or 0.2 mL double distilled water (DDW) depending on sample size.
- Ships as lyophilized powder at room temperature; store at -20°C upon arrival.
- Reconstituted solution can be stored at 4°C for up to 1 week; for longer storage, aliquot and keep at -20°C.
- Avoid repeated freeze/thaw cycles.
- Centrifuge all antibody preparations before use (10,000 × g, 5 min).
Target Information
CACNA1C encodes the alpha-1 subunit of a voltage-dependent calcium channel.
Calcium channels mediate calcium ion influx upon membrane polarization.
The alpha-1 subunit has 24 transmembrane segments and forms the ion-conducting pore.
The functional channel complex includes alpha-1, alpha-2/delta, beta, and gamma subunits (1:1:1:1 ratio).
Multiple isoforms arise from distinct genes or alternative splicing events.
The CACNA1C protein binds to and is inhibited by dihydropyridine.
Alternative splicing produces diverse transcript variants encoding different proteins.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific CaV3.2 (CACNA1H) Polyclonal Antibody
742,000원

Thermo Fisher Scientific
Thermo Fisher Scientific TRPC6 Polyclonal Antibody
742,000원

Thermo Fisher Scientific
Thermo Fisher Scientific CaV1.2a (CACNA1C) Polyclonal Antibody
742,000원

Thermo Fisher Scientific
Thermo Fisher Scientific TRPC4 Polyclonal Antibody
742,000원

Thermo Fisher Scientific
Thermo Fisher Scientific CACNA2D1 (CaV alpha 2 delta 1) (extracellular) Polyclonal Antibody
742,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|