
Atlas Antibodies Anti-MRPL38 Antibody
Human MRPL38 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 제조되었으며, 고순도와 높은 특이성을 제공. 인간에 대한 검증 완료 및 교차 반응 정보 제공.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MRPL38 Antibody
Target: mitochondrial ribosomal protein L38 (MRPL38)
Type: Polyclonal Antibody against Human MRPL38
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Validation:
Independent antibody validation — protein expression in WB confirmed by comparison of antibodies targeting different epitopes.
Product Description
Polyclonal antibody raised in rabbit against human MRPL38 (mitochondrial ribosomal protein L38).
Alternative Gene Names
HSPC262, MGC4810, MRP-L3, RPML3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | mitochondrial ribosomal protein L38 |
| Target Gene | MRPL38 |
| Antigen Sequence | EYFGEKTDPKEKIDIGLPPPKVSRTQQLLERKQAIQELRANVEEERAARLRTASVPLDAVRAEWERTCGPYHKQRL |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000020775 (83%), Rat ENSRNOG00000008256 (80%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2), containing 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MRPL38 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPL39 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPL38 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPL37 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPL37 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|