CacheBy
Atlas Antibodies Anti-MRPL38 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MRPL38 Antibody

상품 한눈에 보기

Human MRPL38 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 제조되었으며, 고순도와 높은 특이성을 제공. 인간에 대한 검증 완료 및 교차 반응 정보 제공.

카탈로그번호
HPA023054-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA023054-100 Anti-MRPL38 Antibody, mitochondrial ribosomal protein L38 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023054-25 Anti-MRPL38 Antibody, mitochondrial ribosomal protein L38 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MRPL38 Antibody

Anti-MRPL38 Antibody

Target: mitochondrial ribosomal protein L38 (MRPL38)
Type: Polyclonal Antibody against Human MRPL38

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Validation:
Independent antibody validation — protein expression in WB confirmed by comparison of antibodies targeting different epitopes.

Product Description

Polyclonal antibody raised in rabbit against human MRPL38 (mitochondrial ribosomal protein L38).

Alternative Gene Names

HSPC262, MGC4810, MRP-L3, RPML3

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein mitochondrial ribosomal protein L38
Target Gene MRPL38
Antigen Sequence EYFGEKTDPKEKIDIGLPPPKVSRTQQLLERKQAIQELRANVEEERAARLRTASVPLDAVRAEWERTCGPYHKQRL
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000020775 (83%), Rat ENSRNOG00000008256 (80%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2), containing 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC
WB Independent
Independent Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.