
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MRPL38 Antibody
상품 한눈에 보기
Human MRPL38 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 제조되었으며, 고순도와 높은 특이성을 제공. 인간에 대한 검증 완료 및 교차 반응 정보 제공.
- 카탈로그번호
- HPA023054-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA023054-100 Anti-MRPL38 Antibody, mitochondrial ribosomal protein L38 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023054-25 Anti-MRPL38 Antibody, mitochondrial ribosomal protein L38 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MRPL38 Antibody
Anti-MRPL38 Antibody
Target: mitochondrial ribosomal protein L38 (MRPL38)
Type: Polyclonal Antibody against Human MRPL38
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Validation:
Independent antibody validation — protein expression in WB confirmed by comparison of antibodies targeting different epitopes.
Product Description
Polyclonal antibody raised in rabbit against human MRPL38 (mitochondrial ribosomal protein L38).
Alternative Gene Names
HSPC262, MGC4810, MRP-L3, RPML3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | mitochondrial ribosomal protein L38 |
| Target Gene | MRPL38 |
| Antigen Sequence | EYFGEKTDPKEKIDIGLPPPKVSRTQQLLERKQAIQELRANVEEERAARLRTASVPLDAVRAEWERTCGPYHKQRL |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000020775 (83%), Rat ENSRNOG00000008256 (80%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2), containing 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



