Atlas Antibodies Anti-MRPL37 Antibody
상품 한눈에 보기
인간 MRPL37 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대한 검증된 반응성을 가지며, 미토콘드리아 리보솜 단백질 연구에 활용 가능합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MRPL37 Antibody
Target: mitochondrial ribosomal protein L37
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Validation:
Independent antibody validation in WB comparing antibodies targeting different epitopes of MRPL37.
Product Description
Polyclonal antibody against Human MRPL37
Alternative Gene Names
- MRP-L2
- RPML2
Antigen Information
Antigen Sequence (PrEST):
TDGRVFHFLVFQLNTTDLDSNEGVKNLAWVDSDQLLYQHFWCLPVIKKRVVVEPVGPVGFKPETFRKFLALYLHGA
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000009078 | 86% |
| Mouse | ENSMUSG00000028622 | 84% |
Antibody Properties
| Parameter | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide |
| Purification | Affinity purified using PrEST antigen as ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Atlas Antibodies
Atlas Antibodies Anti-MRPL38 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-MRPL37 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-MRPL37 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-MRPL37 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-MRPL36 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.