CacheBy
Atlas Antibodies Anti-MRPL39 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MRPL39 Antibody

상품 한눈에 보기

Human MRPL39 단백질을 인식하는 Rabbit Polyclonal 항체로 IHC와 WB에 적합. Affinity purification으로 높은 특이성과 재현성 제공. 인간, 마우스, 랫트 반응 검증. PBS/glycerol buffer로 안정화되어 장기 보관 가능.

카탈로그번호
HPA018331-xxx (2개 옵션)
카테고리
Primary Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018331-100 Anti-MRPL39 Antibody, mitochondrial ribosomal protein L39 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018331-25 Anti-MRPL39 Antibody, mitochondrial ribosomal protein L39 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MRPL39 Antibody

Anti-MRPL39 Antibody

Target: mitochondrial ribosomal protein L39 (MRPL39)
Type: Polyclonal Antibody against Human MRPL39


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Alternative Gene Names

C21orf92, FLJ20451, L39mt, MGC104174, MGC3400, MRP-L5, MSTP003, PRED22, PRED66, RPML5

Open Datasheet


Target Information

항목 내용
Target Protein mitochondrial ribosomal protein L39
Target Gene MRPL39
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence ERIVKLHRIGDFIDVSEGPLIPRTSICFQYEVSAVHNLQPTQPSLIRRFQGVSLPVHLRAHFTIWDKLLERSRKMVTEDQSKAT

Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000047563 (86%)
  • Mouse ENSMUSG00000022889 (86%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.