
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MRPL39 Antibody
상품 한눈에 보기
Human MRPL39 단백질을 인식하는 Rabbit Polyclonal 항체로 IHC와 WB에 적합. Affinity purification으로 높은 특이성과 재현성 제공. 인간, 마우스, 랫트 반응 검증. PBS/glycerol buffer로 안정화되어 장기 보관 가능.
- 카탈로그번호
- HPA018331-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA018331-100 Anti-MRPL39 Antibody, mitochondrial ribosomal protein L39 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018331-25 Anti-MRPL39 Antibody, mitochondrial ribosomal protein L39 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MRPL39 Antibody
Anti-MRPL39 Antibody
Target: mitochondrial ribosomal protein L39 (MRPL39)
Type: Polyclonal Antibody against Human MRPL39
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Alternative Gene Names
C21orf92, FLJ20451, L39mt, MGC104174, MGC3400, MRP-L5, MSTP003, PRED22, PRED66, RPML5
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | mitochondrial ribosomal protein L39 |
| Target Gene | MRPL39 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | ERIVKLHRIGDFIDVSEGPLIPRTSICFQYEVSAVHNLQPTQPSLIRRFQGVSLPVHLRAHFTIWDKLLERSRKMVTEDQSKAT |
Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000047563 (86%)
- Mouse ENSMUSG00000022889 (86%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



