Atlas Antibodies Anti-MRPL38 Antibody

상품 한눈에 보기

인간 MRPL38 단백질을 표적으로 하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합하며, 독립 항체 검증으로 신뢰성 확보. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공.

카탈로그번호: HPA023135-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA023135-100 Anti-MRPL38 Antibody, mitochondrial ribosomal protein L38 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA023135-25 Anti-MRPL38 Antibody, mitochondrial ribosomal protein L38 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-MRPL38 Antibody

Anti-MRPL38 Antibody

Target: mitochondrial ribosomal protein L38

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB) – Independent antibody validation
Immunocytochemistry (ICC)

Independent antibody validation: Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal antibody against Human MRPL38

Alternative Gene Names

HSPC262, MGC4810, MRP-L3, RPML3

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	mitochondrial ribosomal protein L38
Target Gene	MRPL38
Antigen Sequence	EYFGEKTDPKEKIDIGLPPPKVSRTQQLLERKQAIQELRANVEEERAARLRTASVPLDAVRAEWERTCGPYHKQRL
Verified Species Reactivity	Human
Interspecies Homology	Mouse ENSMUSG00000020775 (83%), Rat ENSRNOG00000008256 (80%)

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2); 0.02% sodium azide preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand