CacheBy
Atlas Antibodies Anti-MRPL2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MRPL2 Antibody

상품 한눈에 보기

인간 MRPL2 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 및 WB에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 높은 특이성과 재현성을 제공하며, 미토콘드리아 리보솜 단백질 연구에 유용합니다.

카탈로그번호
HPA064814-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA064814-100 Anti-MRPL2 Antibody, mitochondrial ribosomal protein L2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA064814-25 Anti-MRPL2 Antibody, mitochondrial ribosomal protein L2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MRPL2 Antibody

Anti-MRPL2 Antibody

Target: Mitochondrial ribosomal protein L2 (MRPL2)
Host: Rabbit
Clonality: Polyclonal
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human MRPL2, a mitochondrial ribosomal protein involved in mitochondrial translation.


Alternative Gene Names

CGI-22, MRP-L14, RPML14

Open Datasheet (PDF)


Target Information

  • Target Protein: Mitochondrial ribosomal protein L2
  • Target Gene: MRPL2
  • Verified Species Reactivity: Human
  • Interspecies Identity:
    • Rat (ENSRNOG00000018057): 71%
    • Mouse (ENSMUSG00000002767): 71%

Antigen Information

  • Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    PAPSLFPAAQMMNNGLLQQPSALMLLPCRPVLTSVALNANFVSWKSRTKYTITPVKMRKSGGRDHTGRIRVHGIGGGHKQRYRMIDFLRFRPEETKSGPFEEKVIQVRYDP

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
Purification Affinity purified using PrEST antigen
Storage Gently mix before use. Store according to supplier recommendations.
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.