
Atlas Antibodies Anti-MRPL2 Antibody
상품 한눈에 보기
인간 MRPL2 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 및 WB에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 높은 특이성과 재현성을 제공하며, 미토콘드리아 리보솜 단백질 연구에 유용합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MRPL2 Antibody
Target: Mitochondrial ribosomal protein L2 (MRPL2)
Host: Rabbit
Clonality: Polyclonal
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human MRPL2, a mitochondrial ribosomal protein involved in mitochondrial translation.
Alternative Gene Names
CGI-22, MRP-L14, RPML14
Target Information
- Target Protein: Mitochondrial ribosomal protein L2
- Target Gene: MRPL2
- Verified Species Reactivity: Human
- Interspecies Identity:
- Rat (ENSRNOG00000018057): 71%
- Mouse (ENSMUSG00000002767): 71%
Antigen Information
- Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
PAPSLFPAAQMMNNGLLQQPSALMLLPCRPVLTSVALNANFVSWKSRTKYTITPVKMRKSGGRDHTGRIRVHGIGGGHKQRYRMIDFLRFRPEETKSGPFEEKVIQVRYDP
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide |
| Purification | Affinity purified using PrEST antigen |
| Storage | Gently mix before use. Store according to supplier recommendations. |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MRPL21 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPL20 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPL2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPL19 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPL2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.