
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MRPL2 Antibody
상품 한눈에 보기
인간 MRPL2 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 및 WB에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 높은 특이성과 재현성을 제공하며, 미토콘드리아 리보솜 단백질 연구에 유용합니다.
- 카탈로그번호
- HPA064814-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA064814-100 Anti-MRPL2 Antibody, mitochondrial ribosomal protein L2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA064814-25 Anti-MRPL2 Antibody, mitochondrial ribosomal protein L2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MRPL2 Antibody
Anti-MRPL2 Antibody
Target: Mitochondrial ribosomal protein L2 (MRPL2)
Host: Rabbit
Clonality: Polyclonal
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human MRPL2, a mitochondrial ribosomal protein involved in mitochondrial translation.
Alternative Gene Names
CGI-22, MRP-L14, RPML14
Target Information
- Target Protein: Mitochondrial ribosomal protein L2
- Target Gene: MRPL2
- Verified Species Reactivity: Human
- Interspecies Identity:
- Rat (ENSRNOG00000018057): 71%
- Mouse (ENSMUSG00000002767): 71%
Antigen Information
- Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
PAPSLFPAAQMMNNGLLQQPSALMLLPCRPVLTSVALNANFVSWKSRTKYTITPVKMRKSGGRDHTGRIRVHGIGGGHKQRYRMIDFLRFRPEETKSGPFEEKVIQVRYDP
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide |
| Purification | Affinity purified using PrEST antigen |
| Storage | Gently mix before use. Store according to supplier recommendations. |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.




