CacheBy
Atlas Antibodies Anti-MRPL19 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MRPL19 Antibody

상품 한눈에 보기

Human MRPL19 단백질을 인식하는 rabbit polyclonal 항체로, mitochondrial ribosomal protein L19 검출에 사용됩니다. ICC 등 다양한 응용에 적합하며, 고순도의 affinity 정제 방식으로 제조되었습니다.

카테고리
Primary Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046805-100 Anti-MRPL19 Antibody, mitochondrial ribosomal protein L19 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046805-25 Anti-MRPL19 Antibody, mitochondrial ribosomal protein L19 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MRPL19 Antibody

Anti-MRPL19 Antibody

Target: mitochondrial ribosomal protein L19 (MRPL19)
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human MRPL19.


Alternative Gene Names

KIAA0104, MRP-L15, RLX1, RPML15

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein mitochondrial ribosomal protein L19
Target Gene MRPL19
Verified Species Reactivity Human
Interspecies Identity Mouse (92%), Rat (92%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LRVTTADPYASGKISQFLGICIQRSGRGLGATFILRNVIEGQGVEICFELYNPRVQEIQVVKLEKRLDDSLLYLRDALPEYST

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.