CacheBy
Atlas Antibodies Anti-MRPL21 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MRPL21 Antibody

상품 한눈에 보기

인간 MRPL21 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 실험에 적합합니다. 토끼에서 생산된 IgG 항체이며, 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. PBS 기반 버퍼에 글리세롤과 방부제가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051657-100 Anti-MRPL21 Antibody, mitochondrial ribosomal protein L21 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051657-25 Anti-MRPL21 Antibody, mitochondrial ribosomal protein L21 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MRPL21 Antibody

Anti-MRPL21 Antibody

Target: mitochondrial ribosomal protein L21 (MRPL21)
Type: Polyclonal Antibody against Human MRPL21


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human mitochondrial ribosomal protein L21 (MRPL21).
This antibody is affinity purified using the PrEST antigen as affinity ligand.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein mitochondrial ribosomal protein L21
Target Gene MRPL21
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
ACSHSILRPSGPGAASLWSASRRFNSQSTSYLPGYVPKTSLSSPPWPEVVLPDPVEETRHHAEVV
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000024829 (83%)
Rat ENSRNOG00000013845 (82%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.