Atlas Antibodies Anti-MRPL20 Antibody

상품 한눈에 보기

Human MRPL20 단백질을 인식하는 Rabbit polyclonal 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. 재조합 발현 검증 완료.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA047074-100 Anti-MRPL20 Antibody, mitochondrial ribosomal protein L20 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA047074-25 Anti-MRPL20 Antibody, mitochondrial ribosomal protein L20 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: mitochondrial ribosomal protein L20 (MRPL20)
Supplier: Atlas Antibodies

IHC (Immunohistochemistry)
WB (Western Blot, Recombinant expression validation)
- Recombinant expression validation in WB using target protein overexpression.
ICC (Immunocytochemistry)

Polyclonal antibody against Human MRPL20.

항목	내용
Target Protein	mitochondrial ribosomal protein L20
Target Gene	MRPL20
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	ASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSLAALASRRRHEGFAAALGDGKEPEGIFSRVVQYH

종	유전자 ID	항원 서열 일치율
Rat	ENSRNOG00000018647	91%
Mouse	ENSMUSG00000029066	91%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand