Thermo Fisher Scientific SUR1 Polyclonal Antibody, DyLight 488
DyLight 488 형광 표지된 Thermo Fisher Scientific의 SUR1 폴리클로날 항체. 인간 SUR1 단백질을 인식하며 Flow Cytometry에 적합. 항원 친화 크로마토그래피로 정제됨. 4°C 암소 보관, 동결 금지.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
- Flow Cytometry (Flow): 1–3 µg/1×10⁶ cells
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human SUR1 (TIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVTERKA) |
| Conjugate | DyLight™ 488 |
| Excitation / Emission Max | 492 / 519 nm |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 50% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | 4°C, store in dark, DO NOT FREEZE |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745813 |
Target Information
The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters, which transport various molecules across extra- and intra-cellular membranes. This protein belongs to the MRP subfamily involved in multi-drug resistance and functions as a modulator of ATP-sensitive potassium channels and insulin release.
Mutations and deficiencies in this protein are associated with hyperinsulinemic hypoglycemia of infancy and non-insulin-dependent diabetes mellitus type II. Alternative splicing has been observed, but transcript variants are not fully characterized.
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
제품 이미지
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific ABCG5 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ABCE1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SUR1 Polyclonal Antibody, DyLight 488
661,800원
Thermo Fisher Scientific
Thermo Fisher Scientific ABCG4 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ABCG5 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|