Thermo Fisher Scientific SUR1 Polyclonal Antibody, DyLight 488
DyLight 488 형광 표지된 Thermo Fisher Scientific의 SUR1 폴리클로날 항체. 인간 SUR1 단백질을 인식하며 Flow Cytometry에 적합. 항원 친화 크로마토그래피로 정제됨. 4°C 암소 보관, 동결 금지.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific SUR1 Polyclonal Antibody, DyLight 488
Applications
- Flow Cytometry (Flow): 1–3 µg/1×10⁶ cells
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human SUR1 (TIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVTERKA) |
| Conjugate | DyLight™ 488 |
| Excitation / Emission Max | 492 / 519 nm |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 50% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | 4°C, store in dark, DO NOT FREEZE |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745813 |
Target Information
The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters, which transport various molecules across extra- and intra-cellular membranes. This protein belongs to the MRP subfamily involved in multi-drug resistance and functions as a modulator of ATP-sensitive potassium channels and insulin release.
Mutations and deficiencies in this protein are associated with hyperinsulinemic hypoglycemia of infancy and non-insulin-dependent diabetes mellitus type II. Alternative splicing has been observed, but transcript variants are not fully characterized.
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
제품 이미지
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.