Thermo Fisher Scientific CHK2 Polyclonal Antibody
CHK2 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot 및 IHC(P)에서 검증됨. 인간, 마우스, 랫트 반응성. 항원 친화 크로마토그래피로 정제된 동결건조 형태. DNA 손상 반응 및 암 연구용으로 적합.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific CHK2 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminus of human Chk2 (465–498aa: KLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746157 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
CHEK2 (CHK2) is a serine/threonine kinase involved in the DNA damage checkpoint pathway. Mutations in CHK2 are associated with various cancers. CHK2 is activated by DNA damage and phosphorylates several modulators of cell cycle control, including tumor suppressor proteins. It can phosphorylate BRCA1, aiding in DNA damage repair. CHK2 acts as a tumor suppressor, with mutations linked to Li-Fraumeni syndrome and predisposition to sarcomas, breast cancer, and brain tumors.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.