
원본
Thermo Fisher Scientific Cofilin 2 Polyclonal Antibody
상품 한눈에 보기
Cofilin 2 단백질을 인식하는 Rabbit Polyclonal Antibody로, WB, IHC, ICC, Flow 등 다양한 응용에 적합. 고순도 항원 친화 크로마토그래피 정제 제품으로, 인간·마우스·랫트 반응성. 연구용으로만 사용 가능.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 03. 오전 07:57
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579037 Cofilin 2 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific Cofilin 2 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC (F)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10^6 cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Cofilin 2 (121–153aa KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746153 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin in a pH-dependent manner. It is involved in the translocation of actin-cofilin complex from cytoplasm to nucleus.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
