
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MAGEB2 Antibody
상품 한눈에 보기
인간 MAGEB2 단백질을 인식하는 Rabbit Polyclonal 항체로, melanoma antigen family B2 타깃 검출에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이도 제공. Human에 반응하며 ICC 등 다양한 응용에 사용 가능.
- 카탈로그번호
- HPA065224-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA065224-100 Anti-MAGEB2 Antibody, melanoma antigen family B2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA065224-25 Anti-MAGEB2 Antibody, melanoma antigen family B2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MAGEB2 Antibody
Anti-MAGEB2 Antibody
Target: Melanoma antigen family B2
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human MAGEB2.
Validated for use in various research applications.
Alternative Gene Names
CT3.2, DAM6, MAGE-XP-2, MGC26438
Target Information
- Target Protein: Melanoma antigen family B2
- Target Gene: MAGEB2
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
EGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFP
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000073069 | 43% |
| Rat | ENSRNOG00000055102 | 40% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Recommended Applications
Immunocytochemistry (ICC)
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



