CacheBy
Atlas Antibodies Anti-MAGEB2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MAGEB2 Antibody

상품 한눈에 보기

인간 MAGEB2 단백질을 인식하는 Rabbit Polyclonal 항체로, melanoma antigen family B2 타깃 검출에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이도 제공. Human에 반응하며 ICC 등 다양한 응용에 사용 가능.

카탈로그번호
HPA065224-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA065224-100 Anti-MAGEB2 Antibody, melanoma antigen family B2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA065224-25 Anti-MAGEB2 Antibody, melanoma antigen family B2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MAGEB2 Antibody

Anti-MAGEB2 Antibody

Target: Melanoma antigen family B2
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human MAGEB2.
Validated for use in various research applications.


Alternative Gene Names

CT3.2, DAM6, MAGE-XP-2, MGC26438


Target Information

  • Target Protein: Melanoma antigen family B2
  • Target Gene: MAGEB2
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    EGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFP

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000073069 43%
Rat ENSRNOG00000055102 40%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Immunocytochemistry (ICC)


Additional Resources

Open Datasheet (PDF)


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.