
Atlas Antibodies Anti-MAGEB2 Antibody
상품 한눈에 보기
인간 MAGEB2 단백질을 인식하는 Rabbit Polyclonal 항체로, melanoma antigen family B2 타깃 검출에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이도 제공. Human에 반응하며 ICC 등 다양한 응용에 사용 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MAGEB2 Antibody
Target: Melanoma antigen family B2
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human MAGEB2.
Validated for use in various research applications.
Alternative Gene Names
CT3.2, DAM6, MAGE-XP-2, MGC26438
Target Information
- Target Protein: Melanoma antigen family B2
- Target Gene: MAGEB2
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
EGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFP
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000073069 | 43% |
| Rat | ENSRNOG00000055102 | 40% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Recommended Applications
Immunocytochemistry (ICC)
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MAGEC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAGEB18 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAGEB2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAGEB1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAGEA11 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.