Atlas Antibodies Anti-MAGEC1 Antibody

상품 한눈에 보기

Human MAGEC1 단백질을 인식하는 고품질 폴리클로날 항체로, IHC 및 WB에서 정교한 Orthogonal Validation 수행. Rabbit 유래 IgG로 PrEST 항원 친화 정제. 인체 특이적 반응성 검증 완료.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA004622-100 Anti-MAGEC1 Antibody, melanoma antigen family C, 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA004622-25 Anti-MAGEC1 Antibody, melanoma antigen family C, 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

melanoma antigen family C, 1

IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Polyclonal Antibody against Human MAGEC1

CT7, CT7.1, MAGE-C1, MGC39366

항목	내용
Target Protein	melanoma antigen family C, 1
Target Gene	MAGEC1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000002940 (31%), Mouse ENSMUSG00000110939 (30%)

Antigen Sequence:

QIPQSSPEGDDTQSPLQNSQSSPEGKDSLSPLEISQSPPEGEDVQSPLQNPASSFFSSALLSIFQSSPESTQSPFEGFPQSVLQIPVSAASSSTLVSIFQ

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand