Atlas Antibodies Anti-MAGEA11 Antibody
| 상품 옵션 정보 | ||||||||
|---|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA052687-100 | - | Atlas Antibodies HPA052687-100 Anti-MAGEA11 Antibody, melanoma antigen family A11 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA052687-25 | - | Atlas Antibodies HPA052687-25 Anti-MAGEA11 Antibody, melanoma antigen family A11 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-MAGEA11 Antibody
melanoma antigen family A11
Recommended Applications
Product Description
Polyclonal Antibody against Human MAGEA11
Alternative Gene Names
CT1.11, MAGE-11, MAGE11, MAGEA-11, MGC10511
Target Protein
melanoma antigen family A11
Target Gene
MAGEA11
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
PSTSPDLIDPESFSQDILHDKIIDLVHLLLRKYRVKGLITKAEM
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Mouse ENSMUSG00000031179 (45%)
Rat ENSRNOG00000054784 (43%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|