AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LYZL4 Antibody
상품 한눈에 보기
휴먼 LYZL4 단백질을 타깃으로 하는 폴리클로날 항체. IHC 및 WB(재조합 발현) 검증 완료. 토끼 유래 IgG, 프레스티 항원으로 친화 정제. 인간에 특이적 반응성을 보이며, 최적 조건은 사용자 설정 필요.
- 카탈로그번호
- HPA038806-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA038806-100 Anti-LYZL4 Antibody, lysozyme-like 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038806-25 Anti-LYZL4 Antibody, lysozyme-like 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LYZL4 Antibody
Anti-LYZL4 Antibody
Target: lysozyme-like 4 (LYZL4)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) — Recombinant expression validation using target protein overexpression
Product Description
Polyclonal antibody against human LYZL4.
Alternative Gene Names
LYC4, MGC26768
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
YILGRCTVAKKLHDGGLDYFEGYSLENWVCLAYFESKFNPMAIYENTREGYTGFGLFQMRGSD
Verified Species Reactivity
- Human
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Rat (ENSRNOG00000019350): 79%
- Mouse (ENSMUSG00000032530): 76%
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.