CacheBy
Atlas Antibodies Anti-LZIC Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LZIC Antibody

상품 한눈에 보기

Human LZIC 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 Western blot 검증 완료. 재조합 발현 기반 검증으로 높은 특이성과 재현성 제공. 친화 정제 방식으로 순도 향상. 인간, 랫드, 마우스 간 높은 항원 서열 일치.

카탈로그번호
HPA028184-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028184-100 Anti-LZIC Antibody, leucine zipper and CTNNBIP1 domain containing 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028184-25 Anti-LZIC Antibody, leucine zipper and CTNNBIP1 domain containing 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LZIC Antibody

Anti-LZIC Antibody

Target: leucine zipper and CTNNBIP1 domain containing
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Recombinant expression validation using target protein overexpression

Product Description

Polyclonal antibody against Human LZIC.


Alternative Gene Names

  • MGC15436

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein leucine zipper and CTNNBIP1 domain containing
Target Gene LZIC
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence MASRGKTETSKLKQNLEEQLDRLMQQLQDLEECREELDTDEYEETKKETLEQLSEFNDSLKKIMSGNMTLVDELSGMQLAIQAAISQAFK

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000016200 99%
Mouse ENSMUSG00000028990 99%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide (preservative). Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.